Greece - Yunanistan Manufacturers, Wholesale Suppliers Products from GreeceTurkey - Türkiye Manufacturers, Wholesale Suppliers Products from TurkeyCyprus - Kibris Manufacturers, Wholesale Suppliers Products from Cyprus
Greece & Turkey Bazaar - WTPFED.TradeHolding.com
Greece - Yunanistan Manufacturers, Wholesale Suppliers Greece - Trade LeadsTurkey - Türkiye Manufacturers, Wholesale Suppliers Turkey - Trade LeadsCyprus - Kibris Manufacturers, Wholesale Suppliers Cyprus - Trade Leads
Trade Leads Directory -> All Trade Leads -> Chemicals -> Pharmaceutical Products -> GHRH 1-44
Greece & Turkey Bazaar - View Trade Lead - GHRH 1-44
Cyprus Trade Leads, Buyers, Sellers Greece Trade Leads, Buyers, Sellers Turkey Trade Leads, Buyers, Sellers Quick Search    Home    Site Map    Terms of Service    Help
Join FREE!   
Manufacturers  Distributors / Wholesalers  Trading Companies  Agents  Buying Offices  Importers / Exporters

GHRH 1-44 (Offer to Sell)

Peptide4u
 Top Member - Become a Top MemberRespond Online Now!
Get Contact Details Now!


Trade Lead Description:

Sequence YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2

Molecular Formula
C 215 H 358 N 72 O66 S

Molecular Weight
5039.76

Purity (HPLC)
95%

Description
A peptide of 44 amino acids in most species that stimulates the release and synthesis of GROWTH HORMONE. GHRF (or GRF) is synthesized by neurons in the ARCUATE NUCLEUS of the HYPOTHALAMUS. After being released into the pituitary portal circulation, GHRF stimulates GH release by the SOMATOTROPHS in the PITUITARY GLAND.
Type of Offer: Offer to Sell
Quantity: 1Gm
Packaging: 10mg
Price / Incoterms Conditions: Not Specified

Posted from China - Shanghai on 19 November, 2015
Contact Information

Join Now or Login
to contact Trade Lead Poster!

 
Company Details
Company Name: Peptide4u Top Member - Become a Top Member
Contact Person: George Lu
Location: China - Shanghai
Hotels in Shanghai, China
Companies from China
Trade Leads from China
Products from China
Classification: Chemicals - Pharmaceutical Products
Similar Trade Leads:
-->> More GHRH 1-44 Trade Leads
Related Site Sections:
* Company Directory: Chemicals - Pharmaceutical Products
* Biz Keywords: Chemicals - Pharmaceutical Products
* Product Showroom: Chemicals - Pharmaceutical Products
* Latest Business News
View More Trade Leads
Search For:

Greece & Turkey Bazaar or and exact phrase
Contact Now!
Peptide4u
Top Member - Become a Top Member Member Website
21 Trade Leads posted
1 Product on sale
Members Login
 E-Mail Address:
 
 Password:
 
  Store my password
 Forgot password?
 Can't login?

 Not a member?
 Register for FREE!

Browse by Continent
Browse by Continent


What's New?

Companies
Products
Trade Leads
Buying Requests
Selling Offers
Opportunities
Popular Searches
pharmaceutical products buyers
vitamin buyers
b1 buyers
b2 buyers
b5 buyers
b12 buyers
c buyers
nicotinamide buyers
medicine buyers
veterinary products buyers
paracetamol buyers
Quick Links
  Home
  Browse by Country
  Browse Trade Leads
  Browse Companies
  Browse Products
  Top Products
  Top Searches
  Top Sites
  Browse Biz Keywords
  Partner / Trade Links
Advertisement



More Resources
Company Directory
Trade Lead Directory
Product Directory
Cyprus Companies, Business Directory
Greece Companies, Business Directory
Turkey Companies, Business Directory
Greece Directory Greece - Yunanistan Buyers, SellersTurkey Directory Turkey - Türkiye Buyers, SellersCyprus Directory Cyprus - Kibris Buyers, Sellers
- Advertisement -
TradeAegea.com is an innovative Mediterranean B2B Marketplace designed to help Aegean (Turkey, Greece, Cyprus) Manufacturers and Suppliers find new business partners from all over the world. To announce your company to the whole world, among other Featured Companies: Simply, add your company description and your company logo. You can easily search through the Company and the Trade Leads directory by both country and industry classifications. Top Sellers, Exporters
Home - Directory - Products - Terms of Service - Top Searches - About Us - Help - Contact Us

© Copyright 2002-2024, Premier World Ltd. - All Rights Reserved.
Statistics: Companies: 641,200+, Trade Leads: 160,300+, Products: 104,200+, Contacts / Replies: 8,283,600+
There are currently 43641 users online browsing our B2B network. 2:13 GMT, Thursday, December 19, 2024
Privacy Policy
Important Notice! TradeHolding.com B2B Network does not provide an escrow service! Any member who asks you to pay for their products by Western Union to an agent of "TradeHolding.com B2B Network" is fraud and should be immediately reported to us. Do not pay anything to any member who states your money will be added to TradeHolding.com safety deposit account!
All Trade Leads / Offers / Products / Company Profiles / Images and other user-posted contents are posted by the user and Greece & Turkey Bazaar and TradeHolding.com B2B Network shall not be held liable for any such content. However, TradeHolding.com B2B Network respects the intellectual property, copyright, trademark, trade secret or any other personal or proprietary third party rights and expects the same from others. For concerns, please contact us.